Клонування і аналіз генів легких ланцюгів імуноглобулінів стерляді






    Головна сторінка





Скачати 121.67 Kb.
Дата конвертації05.09.2017
Розмір121.67 Kb.
Типреферат

ЗМІСТ


СПИСОК СКОРОЧЕНЬ................................................ .............................................. 3


ВСТУП................................................. .................................................. .......................... 4


ОГЛЯД ЛІТЕРАТУРИ................................................ .................................................. .... 5

БУДОВА імуноглобулінів ................................................ ................................... 5

Геномної ОРГАНІЗАЦІЯ та експресії

Генів L-КІЛ ІГ У ССАВЦІВ ........................................... ......................... 7

Геномної ОРГАНІЗАЦІЯ та експресії

Генів L-КІЛ ІГ У НИЖЧИХ хребетних .......................................... ............ 11

ЕВОЛЮЦІЯ ГЕНІВ L-КІЛ ІГ ............................................ ........................................... 19


МАТЕРІАЛИ ТА МЕТОДИ............................................... ............................................ 24

ЕЛЕКТРОФОРЕЗ ДНК ................................................ .................................................. .......... 24

ВИДІЛЕННЯ ДНК ІЗ ГЕЛЯ .............................................. .................................................. .24

ОТРИМАННЯ РАДІОАКТИВНИХ зонд ............................................... ....................... 25

ВИДІЛЕННЯ плазмідної ДНК ............................................... ....................................... 26

ОЧИЩЕННЯ плазмідної ДНК методом РІВНОВАЖНОГО

Центрифугування в градієнті ЩІЛЬНОСТІ CsCl ........................................ 26

ТРАНСФОРМАЦІЯ прокаріотів клітин ............................................... .... 27

ВИДІЛЕННЯ ЛЕЙКОЦИТІВ ІЗ КРОВІ РИБ ............................................. .................... 28

ВИДІЛЕННЯ СУМАРНОЮ РНК ІЗ ЛЕЙКОЦИТІВ ............................................. ........ 28

ВИДІЛЕННЯ високомолекулярних ДНК

З еукаріотів ............................................... ...................................... 28

КОНСТРУЮВАННЯ БІБЛІОТЕКИ кДНК ............................................... ....................... 29

ПОЛІМЕРАЗНА ЛАНЦЮГОВА РЕАКЦІЯ............................................... ................................ 33

СУБКЛОНІРОВАНІЕ ДНК ................................................ .................................................. .34

СКРИНІНГ БІБЛІОТЕКИ кДНК ............................................... ......................................... 34

ВИЗНАЧЕННЯ НУКЛЕОТИДНОЇ ПОСЛІДОВНОСТІ ДНК ............................. 35

Саузерну блотом ГІБРИДИЗАЦІЯ ............................................... ...................................... 36


РЕЗУЛЬТАТИ ................................................. .................................................. .................. 38

КОНСТРУЮВАННЯ БІБЛІОТЕКИ кДНК І ЇЇ СКРИНІНГ ..................................... 38

ВИЗНАЧЕННЯ ПЕРВИННОЇ СТРУКТУРИ ............................................... ....................... 40

Порівняльний аналіз ПЕРВИННОЇ СТРУКТУРИ .............................................. 40

АНАЛІЗ геномної ОРГАНІЗАЦІЯ ............................................... ............................... 41


ОБГОВОРЕННЯ ................................................. .................................................. ................. 46


ВИСНОВКИ ................................................. .................................................. ............................ 48


СПИСОК ЛІТЕРАТУРИ................................................ ................................................ 49

СПИСОК СКОРОЧЕНЬ


ІГ імуноглобуліни

пн пар нуклеотидів

тпн тисяч пар нуклеотидів

Е.А. одиниця активності

ІПТГ ізопропілтіогалактозід

ТЕМЕД N, N, N, 'N'-тетраметил-етилен-діамін

трис трис (гідроксиметил) амінометан

дНTФ дезоксіаденозінтріфосфат

ддНТФ дідезоксінеклеотідтріфосфат

дНТФ дезоксінуклеотідтріфосфат

рATФ рібоаденозінтріфосфат

ДТТ дітіотрейтол

Na 2 ЕДТА етилендіамінтетраацетат натрію

SDS додецилсульфат натрію

X-Gal 5-бромо-4-хлоро-3-індол-бета-D-галактозид


ВСТУП


В основі функціонування гуморального імунітету у ссавців лежить складний комплекс молекулярно-генетичних і фізіологічних механізмів, що забезпечують реорганізацію, мутагенез і клональную експресію генів імуноглобулінів. Виникнення цієї підсистеми імунітету пов'язують з появою хрящових риб.

На ранніх етапах еволюції гени ІГ були організовані у вигляді повторюваних кластерів VJC генних сегментів. За такої організації розмаїтість продукованих антитіл грунтувалося, перш за все, на кількості тих, що були в геномі кластерів, кожен з яких кодував один варіант поліпептидних субодиниць ІГ. В ході подальшої еволюції стався перехід від кластерної до сегментарної організації, що забезпечує додаткове джерело різноманітності за рахунок комбинативной рекомбінації генних сегментів. Передбачається, що цей перехід також мав важливе значення для регуляції експресії генів і здійснення механізмів клонального відбору антителопродуцирующих клітин в ході імунної відповіді.

Ця робота представляє собою частину проекту, спрямованого на вивчення еволюції механізмів ізотіпіческого виключення генів легких ланцюгів ІГ у нижчих хребетних. Цілями роботи були вивчення структури і організації генів легких ланцюгів ІГ стерляді (Acipenser ruthenus), представника филогенетически древньої групи кістково-хрящових риб.


ОГЛЯД ЛІТЕРАТУРИ


БУДОВА імуноглобулінів


Імуноглобуліни виконують в організмі хребетних функцію гуморальних антитіл і антиген-зв'язуючих рецепторів В-лімфоцитів. Особливістю цього класу білків є велике розмаїття, що дозволяє їм вступати у взаємодію з фактично будь-якими біологічними макромолекулами.

Типова молекула ІГ складається з двох ідентичних важких (H) і двох ідентичних легких (L) поліпептидних ланцюгів. H- і L-ланцюга побудовані з декількох доменів, кожен з яких складається приблизно з 110 амінокислотних залишків. У ссавців існує п'ять класів H-ланцюгів: g, m, a, d, і e. Кожна H-ланцюг побудована з одного N-кінцевого і декількох (трьох або чотирьох) C-кінцевих доменів. N-кінцеві домени різняться в різних молекулах і називаються варіабельними (V) доменами. C-кінцеві домени мають однакову структуру у молекул одного класу і називаються константними (С) доменами (рис. 1) (Пол, 1987).

Серед L-ланцюгів ссавців розрізняють два типи: лямбда і каппа. Кожна L-ланцюг складається з одного вариабельного і одного константного доменів. В індивідуальній молекулі ІГ присутній тільки один тип L-ланцюга (Roitt et al., 1993).

Гігантська розмаїтість ІГ забезпечується перш за все тим, що V і C області кодуються різними генами (генними сегментами), фізично рознесеними в зародковій ДНК.

У формуванні варіабельних доменів H-ланцюгів беруть участь три генних сегменти: варіабельний (V), D-сегмент (від англ. Diversity- різноманітність) і J-сегмент (від англ. Joining- з'єднує). З-області Н-ланцюгів різних класів кодуються окремими генами (Roitt et al., 1993).














Мал. 1. Схема будови молекули імуноглобуліну.

Типова молекула імуноглобуліну містить дві ідентичні легкі (L) і дві ідентичні важкі (H) ланцюга, пов'язані між собою ковалентно дисульфідними зв'язками. Кожна L-ланцюг складається з одного вариабельного (V L) і одного константного (С L) домену.Н-ланцюг складається з одного V H і декількох C Н доменів.

У формуванні зрілого гена L-ланцюга беруть участь три генних сегменти: V-сегмент і J-сегмент кодують V-домен, C-сегмент кодує константних домен. На пізніх стадіях розвитку В-лімфоцита генні сегменти, що кодують варіабельні домени, об'єднуються в різних поєднаннях, утворюючи матрицю для експресії L- і H-ланцюгів (Seidman et al., 1979; Durdik et al., 1984).


Геномної ОРГАНІЗАЦІЯ та експресії генів L-КІЛ ІГ У ССАВЦІВ


Різні види ссавців мають схожу схему організації та експресії генів ІГ. Одним з найбільш вивчених в цьому відношенні видів є людина. Лямбда і каппа ланцюга ІГ у людини кодуються генами, розташованими в різних локусах і на різних хромосомах. Каппа локус складається з великої кількості V k генних сегментів, зібраних в групи, п'яти J k і одного С k сегмента .. Такий тип організації називається сегментарним (рис. 2). Лямбда локус складається з групи V l сегментів, точна кількість яких невідома, і семи пар J l -C l сегментів. Три з них (JC l 4 - JC l 6) є псевдогенами (Hieter et al., 1981; Roitt et al., 1993).

У процесі розвитку В-лімфоцити в кровотворних органах один з V сегментів з'єднується з одним з J сегментів за допомогою сайтспецифической рекомбінації (Schatz et al., 1992). У цей процес втягуються спеціальні олігомерні послідовності: гептил і нонамери, фланкирующие з 3 'боку V сегмент і з 5' боку J сегмент (рис. 3) (Aguilera et al., 1987; Hesse et al., 1989). Відмінною особливістю лямбда і каппа локусів є конфігурація проміжків між гептил і нонамерамі, званих спейсерами. З V і J генними сегментами лямбда типу асоційовані 23 пн і 12 пн спейсери відповідно, а з V і J сегментами каппа типу - 12 пн і 23 пн спейсери (Durdik et al., 1984; Stavnezer et al., 1985).



л









Мал. 2. Схема будови лямбда і каппа локусів генів L-ланцюгів ІГ людини.

Лямбда локус містить багато V l сегментів і сім пар близько розташованих J l -C l. Три з них яляюся псевдогенами (Y). Каппа локус містить багато V k п'ять J k і один C k генний сегмент (Hieter et al., 1981; Roitt et al., 1993).

Позначення: - сигнальні олігомери.






Мал.3. Схема розташування олігонуклеотидних послідовностей, задіяних в сайтспецифической рекомбінації в каппа локусі ссавців. Ці послідовності фланкують з 3 'боку V L сегмент і з 5' боку J L сегмент. Під час рекомбінації гептамер і нонамер одного з V L сегмента об'єднуються з гептамером і нонамером одного з J L сегмента. Це робить можливим з'єднання V L і J L сегментів без порушення рамки трансляції (Aguilera et al., 1987; Hesse et al., 1989).

Позначення: - сигнальні олігомери.


Послідовність, в якій рекомбінують локуси L-ланцюгів, строго впорядкована в часі. Показано, що першими перебудовуються локуси каппа типу, причому якщо в одній хромосомі перебудова виявилася нефункціональної, тобто не привела до появи повноцінного гена, то рекомбінація відбувається в каппа локусі на гомологічною хромосомі. У разі повторної абортивної перебудови аналогічно відбуваються перебудови в лямбда локусах. Якщо в клітці непродуктивно перебудувалися всі чотири локусу, то вона превращатся в 0-клітку і піддається апоптозу. Якщо ж перебудова одного з локусів призвела до утворення функціонального гена, то рекомбінація інших локусів блокується. Деталі механізму блокування невідомі, проте встановлено, що необхідною умовою для нього є транскрипція продуктивно перебудованого гена. В результаті в кожному індивідуальному лімфоцит синтезується тільки один тип L-ланцюгів, каппа або лямбда, і експресія гена відбувається тільки на одній з двох гомологічних хромосом. Ці феномени, звані ізотіпіческім і алельним винятками лежать в основі ключового принципу функціонування імунної системи - принципу клональной селекції (Пол, 1987; Strob, 1987).

В організмі ссавців генерується понад десять мільйонів варіантів антитіл, хоча в геномі міститься значно менша кількість генних сегментів, які можуть брати участь у формуванні варіабельних доменів. У разі L-ланцюгів, основним джерелом різноманіття є комбинативного поєднання V і J сегментів. Додатковим джерелом є зміщення рекомбинационной рамки в місці їх з'єднання. Крім того, V генні сегменти можуть обмінюватися ділянками ДНК з псевдогенами за допомогою генної конверсії. Дуже істотний внесок в різноманітність специфичностей антитіл вносить соматичне мутирование варіабельних генних сегментів в сайтах, що беруть участь у формуванні антигензв'язуючих центру. Соматичне різноманітність генерується при вторинному імунній відповіді шляхом включення Гіпермутаційний механізму в клітинах пам'яті в зародкових центрах лімфатичних вузлів (Tonegawa 1983; Roitt et al., 1993).

Геномної ОРГАНІЗАЦІЯ та експресії генів L-КІЛ ІГ У НИЖЧИХ хребетних


Хрящові риби.

Гуморальну імунну відповідь у вигляді специфічних антитіл виявляється тільки у хребетних. Найбільш примітивними видами, у яких виявлена ​​здатність синтезувати ІГ, є хрящові риби. Представники трьох основних таксонів (акули, скати і химери) продукують антитіла у відповідь на введення широкого спектра антигенів. Однак, на відміну від ссавців, гетерогенність сироваткових антитіл у хрящових риб виражена дуже слабо. Крім того, у них не виявлено дозрівання імунної відповіді - при вторинному введенні антигену спектр антитіл не змінюється (Flajnik, 1996). Результати досліджень останніх років продемонстрували, що організація генів ІГ у хрящових риб також має яскраво виражені особливості.

У хрящових риб виявлені гени трьох типів L-ланцюгів, що локалізуються в різних локусах. У кожному локусі гение сегменти організовані в кластери, які мають по одному V, J і C генному сегменту (рис. 4). Таких кластерів міститься кілька десятків або навіть сотень в одному локусі на відстані 12-15 тпн один від одного (Rast et al., 1994).

Гени першого типу знайдені у разнозубих акули (Heterodontus francisci) (Shamblott and Litman, 1989) і малого ската (Raja erinacea) (Anderson et al., 1995). У акули кластери мають розмір 3-6 тпн. V і J, J і C генні сегменти розділені приблизно 0,5 і 4 ТПН відповідно. У ската V і J сегменти злиті в зародковій ДНК.

Гени другого типу виявлені у плямистої химери (Hydrolagus colliei) (Maisey, 1984), піщаної акули (Carcharhinus plumbeus) (Hohman et al., 1992; Hohman et al., 1993), разнозубих акули і малого ската (У всіх вивчених видів в кластерах цього типу V і J генні сегменти з'єднані вже в зародковому геномі. V і C гeнние сегменти розділені 2-3 тПН.











Мал. 4. Схема будови локусів генів L-ланцюгів ІГ у акули.

Організація генів у акули має кластерний тип. Кожен кластер має розмір 3 - 6 тпн і містить по одному V L, J L і C L генному сегменту.

Виявлено три типи генів L-ланцюгів ІГ. Локуси генів першого і третього типів мають схожу організацію. В цьому випадку V L і J L, J L і C L сегменти розділені приблизно 0,5 і 4 ТПН відповідно (А) (Rast et al., 1994).

У локусі генів другого типу V L і J L сегменти з'єднані вже в зародковому геномі (Б).


Третій тип генів L-ланцюгів знайдений у акули-няньки (Gynglimostoma cirratum) (Greenberg et al., 1993) і разнозубих акули (Rast et al., 1994). У кластерах цього типу V і J, J і C генні сегменти розділені, як і в кластерах першого типу, приблизно 0,5 і 4 ТПН відповідно. V і J генні сегменти фланкируются сайтами специфічної рекомбінації з спейсерами 12 і 23 пн, що відповідає конфігурації спейсерів в локусах каппа типу ссавців. За первинну структуру гени третього типу теж найбільш близькі до генам каппа типу вищих хребетних (гомологія по амінокислотної послідовності становить близько 60%).

Гени цих трьох типів мають між собою низький ступінь гомології: 40-50% по нуклеотидної послідовності З сегментів і 50-60% по послідовності V сегментів (Hohman et al., 1993).

Отримані дані показують, що у хрящових риб є дуже велика кількість генних сегментів. Однак специфіка організації генів виключає комбинативного поєднання сегментів. Все розмаїття антитіл у хрящових риб формується тільки за рахунок експресії великої кількості кластерів.

Дані про нуклеотидних послідовності з різних локусів виявили низьку гетерогенність генів (85-95%), що вказує на відсутність соматичного мутагенезу (Rast et al., 1994).


Костисті риби.

Аналіз сироваткових антитіл печерного сомика (Ictalurus punctatus) показав наявність трьох типів L-ланцюгів з різними молекулярними масами: 26, 24 і 22 кДа. Два види антитіл миші, 3F12 і 1G7, захоплюють більше 90% від загальної кількості імуноглобулінів у реакції иммунопреципитации. При цьому 3F12 антитіла зв'язуються з молекулами, що містять L-ланцюги масою 24 і 22 кДа, а 1G3 антитіла з іншого субпопуляцією, що містить L-ланцюги масою 26 кДа. На основі цих даних L-ланцюги поділяють на два класи, звані F і G (Lobb et al., 1984).

Геномна організація локусу L-ланцюгів G типу має кластерний тип (рис. 5). У кожному кластері міститься по одному J і C сегменту і два V сегм. Варіабельні геннісегменти розташовані завжди в протилежному транскрипционной полярності до J і C сегментами. У ряді геномних клонів один V сегмент розташовувався з 3 'боку від C генного сегмента. Розмір кластера дорівнює приблизно 3 тпн, відстань між кластерами близько 6 тпн (Ghaffari and Lobb, 1993; Bengten, 1994).

Хоча гени L-ланцюгів сомика мають низьку гомології з генами інших хребетних (40-50% по нуклеотидної послідовності), їх можна віднести до каппа типу вищих хребетних, так як схожість з первинної структурі з лямбда типом нижче.Крім того, конфігурація спейсерів має характер каппатипу: 12 пн спейсер асоційований з V, 23 пн спейсер з J сегментом (Ghaffari and Lobb, 1993).

У райдужної форелі (Oncorhynchus mykiss), представника іншого сімейства костистих риб, також виявлені два типи L ланцюгів (Daggfeldt et al., 1993). Один з них (L1) високогомологічен G типу сомика за структурою V і C областей та відповідний локус має подібну організацію.

Мабуть, у цих видів об'єднання V і J сегментів відбувається тільки за рахунок інверсій з відновленням єдиної полярності транскрипції. Різноманітність варіабельних доменів утворюється в результаті комбинативного поєднання V і J сегментів в межах одного кластера. Не виключається, що в перебудови можуть залучатися і сусідні кластери.

Цікавою особливістю костистих риб є дуже висока пропорція мРНК, що представляє так звані стерильні транскрипти (Ghaffari and Lobb, 1993). Ці транскрипти включають в себе тільки С-сегменти і фланкирующие їх 5'і 3'-нетрансльовані ділянки. Кількість стерильних транскриптів у сомика і форелі в 5 разів перевищує кількість повних VJC-транскриптів.








Мал. 5. Геномна організація локусу генів L-ланцюгів ІГ у печерного сомика.

Геннісегменти організовані в кластери. Кожен кластер містить два V L і по одному J L і C L сегменту і має розмір близько 5 тпн. Відстань між J L і C L близько 1000 пн, V L сегменти віддалені від 5 'кінця J L сегмента на 3 тпн. V L сегменти завжди розташовані в протилежній транскрипционной полярності по відношенню J L і C L сегментами (Ghaffari and Lobb, 1993).


Амфібії.

У шпорцевой жаби (Xenopus laevis) виявлено три сімейства генів L-ланцюгів ІГ, що кодують три різних изотипа: L1 (ро), L2 (сигма) і L3 (рис. 6).

Всі три локусу мають сегментарний характер організації. L1 локус містить множинні V L1 сегменти, розділені в геномі 2.1 - 3.6 тпн, п'ять J L1 сегментів, три з яких ідентичні, і один C L1 генний сегмент (Stewart et al., 1993). J L1 і V L1 сегменти фланкируются канонічними гептил і нонамернимі сигнальними послідовностями, розділеними 12 пн у V L1 і 23 пн у J L1 сегментів (Sakano et al., 1980).

Локус генів другого типу розділяється на два сімейства, s 1 і s 2, які в геномі розташовуються окремо. Геном жаби містить множинні V s 1 і кілька V s 2 гених сегментів, одну пару J s 1 -C s 1 і пару J s 2 -C s 2 (Schwager et al., 1991). Розташування генів цього типу один щодо одного точно не визначено.

Нещодавно був виявлений третій тип генів L-ланцюгів у жаби. У геномі жаби міститься шість сімейств V сегментів цього типу. Загальна кількість V L3 елементів становить щонайменше 30 копій. Кожен V L3 елемент може рекомбінувати з однією з двох пар JC L3 генних сегментів (Haire et al., 1996).

Гени трьох типів значно різняться: гомологія на аминокислотном рівні становить приблизно 30% (Zezza et al., 1991). У той же час, ряд ознак дозволяє співвіднести гени L1 і L3 типу з каппа і лямбда типами ссавців.

Сімейство генів першого типу можна віднести до каппа типу з кількох причин (Zezza et al., 1992): а) висока гомологія первинної структури (більше 50%); б) істотна подібність геномної організації локусу (багато V L1 і один C L1 генний сегмент); в) кофігурація спейсеров між гепта- і нонамеримі відповідає каппа типу; г) J L1 і C L1 геннісегменти розділені приблизно 3.5 тпн, що приблизно дорівнює відстані між J L k і C L k елементами людини (Sakano et al., 1979; Hieter et al., 1982) і значно більше ніж відстань між J L l і C L l ссавців (Blomberg et al., 1982; Udey, 1987).














Мал.6. Геномна організація локусу першого і третього типів генів L-ланцюгів ІГ у шпорцевой жаби.

Локус сімейства L1 містить множинні V L1 сегменти, п'ять J L1 сегментів один C L1 генний сегмент. Відстань між V L1 одно 2.1 - 3.6 тпн. Локус сімейства L3 має близько 30 V L3 сегментів, розташованих групами, J L3 і C L3 сегменти розташовуються парами: JC L3 1 і JC L3 2 (Stewart et al., 1993; Haire et al., 1996).

Третій тип генів L-ланцюгів жаби ближчий до лямбда типу ссавців: а) більш висока гомологія з генами лямбда типу ссавців (близько 50% з l - і 30-40% з k-типу по амінокислотної послідовності); б) J L3 і C L3 генні Сементів експресуються завжди парами J L3 1-C L3 1 і J L3 2-C L3 2, що нагадує ситуацію в лямбда локусі людини і миші (Haire et al., 1996).

Гени другого типу L-ланцюгів жаби незначне і приблизно однакове схожість з генами каппа і лямбда типів ссавців (30-40% і 25-40% по нуклеотидної послідовності, соответствено) (Schwager et al., 1991).

Генетична різноманітність у жаби дуже багато і можна порівняти з різноманітністю генів у ссавців. Однак репертуар антитільних специфичностей в сироватці крові значно поступається репертуару вищих хребетних (Hsu et al., 1991). Цей парадокс можна пояснити наявністю механізму соматичної селекції клонів В-лімфоцитів, який елімінує клітини, що несуть антитіла, специфічні до власних антигенів організму, а також ті клітини, які продукують кілька типів антитіл (Wilson et al., 1992).

Основний внесок у формування розмаїття L-ланцюгів антитіл у жаби дають перше і третє сімейства генів, що мають високий комбинативного потенціал і велика різноманітність зародкових V генних (Haire et al., 1996). Друге сімейство має кілька слабо відрізняються один від одного V L2 елементів і не відіграє суттєвої ролі в формуванні різноманітності (Stewart et al., 1993). Таким чином, різноманітність генів L-ланцюгів у жаби а створюється за допомогою: а) комбинативного з'єднання V і J генних сегментів; б) зміщення рекомбинационной рамки при з'єднанні V і J сегментів. Не можна виключити, що певний внесок у різноманітність може вносити соматичний мутагенез. У всякому разі, наявність цього механізму показано для генів H-ланцюгів жаби (Zezza et al., 1992).


ЕВОЛЮЦІЯ ГЕНІВ L-КІЛ ІГ


Згідно найбільш популярної зараз гіпотезі гени ІГ і Т-клітинних рецепторів походять від одного предкового гена, кодувати один домен шляхом різних варіантів послідовних дуплікацій (рис. 7).

В еволюції генів ІГ можна виділити три основні події.

1. Поділ предкового V-подібного гена на V і J сегменти і виникнення механізму генерації різноманітності шляхом соматичної рекомбінації. Передбачається, що ця подія пов'язана з впровадженням транспозона в предковий ген і здійснилося до поділу ІГ і Т-клітинних рецепторів у предків хрящових риб (Gilbert, 1990). Наявність в геномі акул і скатів злитих VJ генів у локусах L-ланцюгів класів I і II, є, мабуть, вторинним подією і, можливо, зумовлено фіксацією генів, що кодують антитіла чітко визначеної специфічності (Anderson et al., 1995).

2. Виникнення механізмів соматичного мутагенезу генів ІГ. У ссавців соматический мутагенез забезпечує як мінімум половину різноманітності антитіл, будучи основою аффинного дозрівання антитіл при вторинному імунній відповіді (Пол, 1987). Досить виражений соматичний мутагенез також у птахів (Thompson and Neiman, 1987; Reynaund et al., 1987).

Ряд даних дозволяє припускати, що соматичний мутагенез може здійснюватися у хрящових риб і в амфібій, але ці результати потребують більш ретельного вивчення. Зокрема, у хрящових риб отримання достовірних свідчень утруднено наявністю множинних кластерів генів, що не дозволяє надійно співвідносити дані по геномної структурі та структурі кДНК (Litman et al., 1993).

3. Перехід від кластерної до сегментарної організації генних сегментів. Сегментарна організація може мати кілька переваг. По-перше, збільшується різноманітність продукуються антитіл за рахунок додаткових можливостей комбінування різних V і J сегментів. По-друге, зменшується розмір локусу за рахунок


























Мал. 7. Гіпотетична схема еволюції структурної організації локусів генів L-ланцюгів ІГ хребетних. (Anderson et al., 1995; Gilbert, 1990).

Позначення: - сигнальні олігомери, фланкирующие V і J сегменти.


різкого скорочення кількості C генів. По-третє, подібна організація дозволяє спростити регуляцію експресії різних локусів.

Ключовим принципом функціонування імунної системи є принцип клональной селекції імунокомпетентних клітин, які мають рецептор певної специфічності. Ряд непрямих даних дозволяє вважати, що у акул гуморальну імунну відповідь клонально обмежений (Shankey and Clem, 1980). Однак невідомо, яким чином і наскільки ефективно здійснюється це обмеження (Flajnik, 1996). У ссавців принцип "одна клітина - одне антитіло" забезпечується завдяки ізотіпіческому і аллельному виключенню. При сегментарної організації генів продуктивна перебудова в одному з локусів веде до блокування перебудови інших локусів і, тим самим до їх інактивації. Однак, в разі наявності множинних VJC кластерів, в частині з яких VJ сегменти злиті в зародковій ДНК, механізми контролю вибіркової експресії можуть бути більш складними або не настільки ефективними. Таким чином, перехід від кластерної до сегментарної формі організації генів ІГ міг мати принципове значення для формування повноцінної системи гуморального імунітету.

Питання про те, на якому етапі філогенезу стався цей перехід залишається відкритим. Вже у амфібій гени ІГ L- і Н-ланцюгів організовані сегментарно. При цьому, в разі L-ланцюгів спостерігається два основних типи організації: каппа-подібний (один З ген, сімейство J сегментів і сімейство V сегментів) і лямбда подібний (кілька пар JC і сімейство V сегментів). По всій видимості, різні типи L-ланцюгів амфібій походять від різних типів L-ланцюгів хрящових риб, проте відносно невисока гомологія по первинній структурі не дозволяє стверджувати цього з певністю (Gilbert, 1990).

У сомика і райдужної форелі, представників костистих риб, організація генів L-ланцюгів і Н-ланцюгів відрізняється. Гени Н-ланцюгів костистих риб організовані подібно до ссавців сегментарно (Bengten et al., 1991). Організація генів L-ланцюгів має кластерний характер. У той же час, на відміну від хрящових риб, Транскрипційні орієнтація V генів у них змінена.

Слід зазначити, що сомів і лососеві є досить спеціалізованої групою, яка виникла в еволюції відносно недавно (Рис. 8). Особливості організації генів легких ланцюгів у цих таксонів можуть являти собою новопридбані ознаки (Romer, 1966).

У зв'язку з цим особливий інтерес представляє вивчення структри і організації генів L-ланцюгів ІГ у кістково-хрящових риб. Кістково-хрящові є архаїчною групою костистих риб, що виникла значно раніше справжніх костистих. Незважаючи на те, що існують різні думки щодо послідовності появи кістково-хрящових і Двоякодихаючих (предків наземних хребетних) (Ромер і Парсонс, 1992; Юдкін І. І., 1941), очевидно, що кістково-хрящові більшою мірою ніж костітстие зберегли риси древніх первинно-кісткових риб і, відповідно, з більшою підставою можуть розглядатися як проміжна ланка між хрящовими рибами і амфібіями.


































Мал. 8. Еволюційний древо нижчих хребетних (по Северцеву А. Н., 1939).

Позначення: - таксони, що мають нині живих представників, - таксони, існування яких доведено палеонтологічними дослідженнями.


МАТЕРІАЛИ ТА МЕТОДИ


ЕЛЕКТРОФОРЕЗ ДНК


У агарозному гелі.

Електрофорез ДНК проводили в 1% агарозному гелі в 1-кратному буфері ТАЕ, що має склад: 0.04 М трис-ацетат, 2 мМ Na 2 ЕДТА (Маніатіс і ін., 1984).


У поліакриламідному гелі.

Електрофорез ДНК проводили в 6% поліакриламідному гелі в 0,5-кратному буфері ТБЕ, що має склад: 0,089 М трис-борат, 0,089 М борна кислота, 2 мМ Na 2 ЕДТА. Для полімеризації гелю до 50 мл розчину додавали 300 мкл 10% розчину персульфата амонію і 30 мкл ТЕМЕД (Маніатіс і ін., 1984).


ВИДІЛЕННЯ ДНК ІЗ ГЕЛЯ


Адсорбція на діетіламіноетілцеллюлозе.

Гель фарбували в розчині бромистого етидія, ділянку гелю з смугою ДНК вирізали, поміщали в камеру і переносили ДНК на діетіламіноетілцеллюлозу в 0,5-кратному буфері ТБЕ (див. Електрофорез ДНК (2)) при напрузі 40 В / см. Елюція ДНК з діетіламіноетілцеллюлози проводили шляхом інкубування протягом 30 хв при 70 о С в буфері, що має склад: 2 мМ NaCl, 1 мМ Na 2 ЕДТА, 40 мМ трис рН 8,0 (Маніатіс і ін., 1984).


Адсорбція на кремнієвій пудрі.

Агарозній гель фарбували в розчині бромистого зтідія, вирізали ділянку гелю з ДНК і розплавляли инкубированием з подвійним об'ємом 6 М розчину KI протягом 10 хв при 55 о С. Потім додавали суспензію кремнієвої пудри (силики) в 3 М розчині KI в концентрації 100 мг / мл з розрахунку 300 мкг силіки на 1 мкг ДНК і інкубували протягом 2 хв при 55 о С. Після цього брали в облогу силіку центрифугуванням при 2000 g протягом 2 хв і двічі промивали суспендированием в розчині, що містить 50 мМ NaCl, 10 мМ трис-HCl , рН 8,0, 2,5 мМ Na 2 ЕДТА і 50% етиловий спирт. Елюювали ДНК з силики суспендированием в воді (Boyle, Lew, 1995).


Заморожування - відтавання.

Агарозній гель з ДНК 10 хв інкубували в рідкому азоті і брали в облогу центрифугуванням при 12000 g протягом 15 хв, після чого додавали до супернатанту 1/10 обсягу 3 М NaAc, 2 обсягу етанолу і брали в облогу ДНК при 12000 g протягом 10 хв.


ОТРИМАННЯ РАДІОАКТИВНИХ зонд


500 нг ДНК-матриці і 100 нг праймера денатуровані в 10 мкл води при 100 ° С протягом 10 хв і швидко охолоджували до 0 о С. Потім додавали 10 мкл 10-кратного буфера (40 мМ KP0 4 рН 7,5, 6, 6 мМ MgCl 2 та 1,0 мМ 2-меркаптоетанол), 0,1-0,5 мКи 32 Р-dATФ, 10 мкл 2 мМ розчину трьох інших немічених дНTФ до концентрації 200 мкМ. Обсяг реакційної суміші доводили водою до 100 мкл, додавали 3 мкл фрагмента Кленова ДНК-полімерази I (10-12 Е.А.) і інкубували при кімнатній температурі протягом 30 хв. Очищення зонда проводили методом гель - фільтрації на колонці з біогелем П-10 (Маніатіс і ін., 1984).


ВИДІЛЕННЯ плазмідної ДНК


Клітини Escherichia coli, вирощені в середовищі Луриа-Бертані (1% NaCl, 1% бакто-триптон, 0,5% бакто-дріжджовий екстракт, рН 7,5) (середа LB) з ампіциліном (50 мкг / мл), брали в облогу центрифугуванням при 4000 g. Потім осад суспендують в буфері STET (8% сахароза, 0,5% тритон X-100, 10 мМ трис-HCl і 50 мМ Na 2 ЕДТА, рН 8,0) і додавали лізоцим до концентрації 0,8 г / мл. Суміш інкубували при кімнатній температурі протягом 5 хв і при 100 ° С протягом 1 хв. Після цього клітинний дебрис облягали центрифугуванням при 16000 g протягом 15 хв.

Для осадження плазмідної ДНК до супернатанту додавали 1/10 обсягу 3 М розчину ацетату натрію, рівний обсяг ізопропанолу і центрифугували при 16000 g протягом 15 хв при 20 о С. Потім промивали осад додаванням 80% етанолу і повторним центрифугуванням протягом 5 хв при 20 о С (Маніатіс і ін., 1984).


ОЧИЩЕННЯ плазмідної ДНК методом РІВНОВАЖНОГО центрифугування в градієнті ЩІЛЬНОСТІ CsCl


На кожні 10 мл розчину плазмідної ДНК, отриманого після осадження лу клітин (див. Виділення плазмідної ДНК), додавали 1 г сухого CsCl, сіль розчиняли, після чого на кожні 10 мл розчину додавали 0,8 мл розчину бромистого етидія з концентрацією 10 мг / мл. Суміш поміщали в центрифужні пробірки Beckman, заповнювали доверху розчином CsCl і бромистого етидія тієї ж щільності і центрифугували в роторі Ti 60 при 45000 об / хв і температурі 20 о С протягом 36 годин. Після цього відбирали кільцеву ковалентно замкнуту плазмидную ДНК і екстрагували бромистий етидій з розчину до повного знебарвлення рівним обсягом н-бутанолу, попередньо насиченого 1 М розчином NaCl.

ДНК облягали центрифугуванням при 15000 g, додавши рівний обсяг 1 М розчину NH 4 Cl і два обсягу етанолу. Після промивання етанолом осад ДНК розчиняли у воді до концентрації 1 мкг / мкл (Маніатіс і ін., 1984).

ТРАНСФОРМАЦІЯ прокаріотів клітин


Хімічна трансформація.

Для підготовки компетентних клітин E.coli штам XL-1 Blue MRF 'і вирощували в 100 мл 2-кратної середовища Луриа (2% бакто-триптон, 1% бакто-дріжджовий екстракт, 0,1% NaCl, 0,4% глюкоза, рН 7,0) при 37 о С до оптичної щільності D 550 = 0,35. Клітинну суспензію витримували при 0 о С протягом 2 годин. Потім клітини осаджували центрифугуванням при 4000 g, температурі 4 о С і суспендованих в 50 мл крижаного буфера А (100 мМ CaCl 2, 70 мМ MnCl 2, 40 мМ NaAc, рН 5,5). Після цього суспензію клітин витримували при 0 о С протягом 30 хв, після чого клітини брали в облогу і суспендованих в 5 мл буфера А з 15% гліцерину.

Для трансформації до 200 мкл суспензії компетентних клітин додавали 30 нг плазмідної ДНК, розчиненої в 100 мкл води і витримували при 0 о С протягом 30 хв. Потім інкубували при 37 о С протягом 5 хв, після чого додавали 3 мл середовища LB і инкубировали при 37 о С ще 90 хв. Клітини збирали центрифугуванням і висівали на селективну середу (Мазин і ін., 1988).


Електротрансформація.

Для підготовки компетентних клітин E.coli штам XL-1 Blue MRF 'вирощували в 100 мл середовища LB (див. Хімічна трансформація) при кімнатній температурі до оптичної щільності D 550 = 0,45. Потім клітини осаджували центрифугуванням при 4000 g, 4 о С і промивали суспендированием послідовно в 100 мл, 50 мл і 10 мл 10% розчину гліцерину при 0-4 о С. Після цього клітини суспендованих в 240 мкл крижаного розчину GYT (10% гліцерин, 0,125 % бакто-дріжджовий екстракт, 0,25% бакто-триптон).

Для трансформації до 40 мкл суспензії компетентних клітин додавали 1 мкл ДНК вектора (50 нг) при 0-4 ° С і пропускали електричний розряд (U = 18000 В). Потім додавали 1 мл SOC (2% бакто-триптон, 0,5% бакто-дріжджовий екстракт, 10 мМ NaCl, 2,5 мМ KCl, 10 мМ MgCl 2, 10 мМ MgSO 4, 20 мМ глюкоза), перемішували, переносили в 3 мл середовища SOC, прогрітій до 42 о С, і інкубували при 37 о С протягом 1 години (Wai Lin Tung and King-C. Chow, 1995).

ВИДІЛЕННЯ ЛЕЙКОЦИТІВ ІЗ КРОВІ РИБ


Кров збирали на холоду через каудальную артерію з додаванням на кожні 5 мл крові 1 мл 2,7% розчину Na 2 ЕДТА, рН 7,4. До виділеної крові додавали рівний об'єм трис-сольового буфера (TBS) (0,14 М NaCl, 5 мМ KCl, 25 мМ трис-HCl, рН 7,4). Суміш наносили при кімнатній температурі на рівний обсяг середовища для виділення лейкоцитів, що містить 24 частини 9% фікола і 10 частин 34% верографина. Після центрифугування при 400 g протягом 30 хв відбирали шар лейкоцитів і розводили у великому обсязі буфера TBS. Після повторного центрифугування при 300 g протягом 40 хв для лізису залишкових еритроцитів клітини суспендованих в розчині, що містить 9 обсягів 0,83% розчину NH 4 Cl і 1 об'єм 2,06% розчину трис-HCl, рН 7,62, до концентрації 10 8 кл / мл і додавали 5 обсягів середовища. Після осадження клітин при 300 g протягом 10 хв процедуру очищення повторили (Фримель, 1987).


ВИДІЛЕННЯ СУМАРНОЮ РНК ІЗ ЛЕЙКОЦИТІВ


Осад лейкоцитів після виділення та очищення суспендованих в 10 об'ємах (1 мл) розчину 1, що містить 4 М гуанидин тиоцианат, 25 мМ цитрат натрію, рН 7,0, 0,5% Саркозі і 0,1 М 2-меркаптоетанол, при кімнатній температурі . Потім додавали 0,1 мл 2 М розчину NaAc, рН 4,0, 1 мл фенолу, 0,2 мл хлороформу і перемішували. Потім центрифугували при 10000 g протягом 20 хв при 4 ° С, відбирали водну фазу, додавали до неї рівний обсяг ізопропанолу і брали в облогу РНК центрифугуванням при 15000 g протягом 15 хв при 4 ° С (Chomczynski and Sacchi, 1987).


ВИДІЛЕННЯ високомолекулярних ДНК ІЗ еукаріотів


1 г печінки стерляді, замороженої в рідкому азоті, розтирали в тонкий порошок і гомогенизировали в 15 мл розчину, що містить 0,5 М Na 2 ЕДТА, рН 8,0, 0,5% Саркозі, 100 мкг / мл протеїнази К і нагрітого до 65 о С. Потім інкубували при 50 о С протягом 3 годин при легкому погойдуванні. Потім, уникаючи різких струшувань, екстрагували ДНК рівним об'ємом фенолу три рази, кожен раз розділяючи фракції центрифугуванням при 4000 g і кімнатній температурі. Фенол попередньо очищали перегонкою і насичували буфером, що містить 1 М трис-HCl, один раз і два рази буфером, що містить 0,1 М трис-HCl і 0,1% 2-меркаптоетанол. Діаліз ДНК проводили при 10 о С протягом 12 годин проти 4 л буфера, що має склад:

50 мМ трис-HCl, рН 8,0,

10 мМ Na 2 ЕДТА,

10 мМ NaCl.

Потім обробляли пробу РНКази, вільної від ДНКази, при 37 о С протягом 1 години в концентрації 100 мкг / мл. Після цього екстрагували ДНК рівним об'ємом суміші фенол-хлороформ (1: 1) два рази і проводили діаліз при 10оС протягом 36 годин проти 10 л буфера TE (10 мМ трис-HCl, 1 мМ Na 2 ЕДТА, рН 7,5 ), змінюючи буфер через кожні 12 годин (Маніатіс і ін., 1984).


КОНСТРУЮВАННЯ БІБЛІОТЕКИ кДНК


Виділення полі (A) + РНК.

Для пригнічення РНКази все розчини, які містять трис, обробляли 0,1% діетілпірокарбонатом 12 годин при 37 о С і автоклавуватися. Посуд прокаливали при 250 ° С протягом 4 годин. Полі (A) + РНК виділяли з сумарною РНК лейкоцитів стерляді методом хроматографії на оліго (dT) -целлюлозе. Для цього РНК розчиняли у воді, прогрівали при 65 о С протягом 5 хв, додавали рівний об'єм 2-кратного буфера для нанесення РНК (40 мМ трис-HCl, рН 7,6, 1 М NaCl, 2 мМ Na 2 ЕДТА, 0 , 2% SDS) і тричі пропускали через колонку з оліго (dT) -целлюлозой. Потім промивали колонку 5-10 обсягами буфера для нанесення і 4 обсягами цього ж буфера, що містить 0,1 М NaCl. Після цього елюювали полі (A) + РНК в 2-3 обсягах води, обробленої діетілпірокарбонатом, додавали 2,2 обсягу етанолу і брали в облогу центрифугуванням протягом 10 хв при 12000 g при 4 о С (Маніатіс і ін., 1984).

Синтез кДНК.

Синтез кДНК проводили відповідно до протоколом фірми Stratagene. По матриці полі (A) + РНК синтезували першу ланцюг кДНК (рис. 9).

Реакційна мала склад:

5 мкл 10-кратного буфера для синтезу першого ланцюга,

3 мкл суміші метил-dНTФ,

2 мкл розчину праймер-линкера (1.4 мкг / мкл),

1 мкл інгібітора РНКазной активності,

1.5 мкл ферменту зворотна транскриптаза (50 Е.А. / мкл),

вода до сумарного обсягу 50 мкл.

Суміш інкубували при 37 о С протягом 1 години. Потім охолоджували до 0 ° С і доблялі компоненти для синтезу другий ланцюга кДНК:

20 мкл буфера для синтезу другий ланцюга,

6 мкл суміші dНTФ,

88,9 мкл стерильної води,

2 мкл 32 Р-dНTФ (800 Кі / мМ),

2 мкл розчину РНКазиH (1.5 Е.А. / мкл),

11.1 мкл ДНК полімерази I.

Суміш інкубували при 16 о С протягом 2,5 годин, потім охолоджували до 0 ° С і додавали компоненти для забудови "липких" кінців:

23 мкл суміші дНTФ,

2 мкл Pfu ДНК полімерази (2,5 Е.А. / мкл).

Суміш інкубували при 72 о С протягом 30 хв.

Потім проводили екстракцію рівним обсягом суміші фенол-хлороформ (1: 1) і рівним обсягом хлороформу, після чого відбирали водну фазу, додавали 20 мкл 3М NaAc і 400 мкл 96% етанолу і брали в облогу кДНК центрифугуванням при 12000 g протягом 12 хв.


Зшивання молекул кДНК з вектором.

кДНК розчиняли з EcoR I Адаптори (рис. 9) і інкубували при 4 о С протягом 30 хв. Потім додавали компоненти для зшивання молекул адаптерів і молеул кДНК:


праймер-линкер

5 'CTCGAGTTTTTTTTTTTT 3'

3 'AAAAAAAAAAAA 5'

полі (A) + РНК



Xho I сайт 1-я ланцюг EcoR I адаптор

5 'р-TCGAGTTTTTTTTTTTT ,,,,,,,, CTCGTGCCG-р 3'

3 'р-CAAAAAAAAAAAA GAGCACGGCTTAA-р 5'

2-я ланцюг





Xho I сайт кДНК EcoR I сайт

5 'CTCGAGTTTTTTT ,,,,,,,,, CTCGTGCCGAATTC 3'

3 'GAGCTCAAAAAAA GAGCACGGCTTAAG 5'

ДНК вектора ДНК вектора


Мал.9. Схема синтезу кДНК по матриці полі (A) + РНК і зшивання з плазмідних вектором

pBluescript KS (+) по сайтам EcoR I і Xho I.

Позначення: ,,,,, - Метилована ланцюг кДНК, -неметілірованная ланцюг кДНК.


1 мкл 10-кратного буфера лигирования,

1 мкл 10 мМ рATФ,

1 мкл ферменту ДНК лігази фага Т4 (4 Е.А. / мкл).

Суміш інкубували при 4 о С протягом 2-х діб, після чого інактивувати лігази прогріванням при 70 о С протягом 30 хв, охолоджували до кімнатної температури і додавали компоненти для фосфорилювання кінцевих нуклеотидів:

1 мкл 10-кратного буфера лигирования,

2 мкл 10 мМ рATФ,

6 мкл стерильної води,

1 мкл ферменту полинуклеотидной кінази фага Т4 (10 Е.А. / мкл).

Реакційну суміш інкубували при 37 о С протягом 30 хв. Потім охолоджували до кімнатної температури і додавали компоненти для освіти липких кінців по сайту рестрикції ендонуклеази Xho I:

28 мкл буфера 4,

3 мкл Xho I (40 Е.А. / мкл).

Суміш інкубували при 37 о С протягом 1,5 години. Потім додавали 5 мкл 10-кратного буфера STE (1 М NaCl, 200 мМ трис-HCl, рН 7,5, 100 мМ Na 2 ЕДТА) і пропускали через колонку з гелем сефакріл С-500. Фракції, що містять молекули з розміром більше 500 пн об'єднували і екстрагували ДНК рівним об'ємом суміші фенол-хлороформ (1: 1) і рівним обсягом хлороформу. Потім додавали подвійний обсяг етанолу, брали в облогу кДНК центрифугуванням, промивали 80% етанолом і розчиняли в 10 мкл води. Для лигирования брали 5 мл розчину кДНК (600 нг) і 2 мкл розчину вектора pBluescript KS (+) (1 мкг), що має "липкі" дефосфорілірованном кінці по сайтам рестрикції ендонуклеаза EcoR I і Xho I (рис. 9).

Потім додавали 1 мкл 10-кратного буфера 3, 1 мкл 10 мМ розчину рATФ і 1 мкл ферменту лігази фага Т4 (4 Е.А. / мкл). Суміш інкубували при 4 о С протягом 2-х діб, після чого екстрагували рівними об'ємами фенол-хлороформу і хлороформу.


Ампліфікація бібліотеки.

Електротрансформацію проводили як описано в п. Трансформація прокаріотичних клітин, після чого висівали 1/1000 обсягу (2,5 мкл) середовища SOC на селективну середу з ампіциліном (50 мкг / мл) для визначення кількості трансформованих клітин. Іншу частину поміщали в 100 мл середовища LB з ампіциліном (50 мкг / мл) і інкубували при 37 о С при перемішуванні до тих пір, поки оптична щільність не досягне величини D 550 = 2-2,5. Потім відбирали 1,6х10 11 клітин, облягали їх центрифугуванням, суспендованих в 4 мл середовища LB і перемішували з 4 мл гліцерину. Отриману бібліотеку зберігали при -70 о С.


ПОЛІМЕРАЗНА ЛАНЦЮГОВА РЕАКЦІЯ


Реакційна суміш полімеразної ланцюгової реакції (ПЛР) містила наступні компоненти:

100 нг ДНК матриці,

100 нг невиродженого праймера,

500 нг виродженого праймера,

5 мкл 2 мМ розчину дНTФ,

5 мкл 1-кратного буфера (10 мМ трис-HCl, рН 8,8, 50 мМ KCl, 1,5 мМ MgCl 2, 0,001% желатин),

1 мкл Taq полімерази,

вода до кінцевого об'єму 50 мкл (Dieffenbach and Dveksler, 1995).

Температурний режим ПЛР.

Реакційну суміш інкубували при 95 о С протягом 5 хв, після чого додавали Taq полімерази і використовували температурний режим, при якому протягом перших 18 циклів температуру відпалу праймерів знижували на 3 ° С черех кожні три цикли:

1 й -18 й цикли 95 о С - 1 хв (денатурація ДНК),

50-35 о С - 1 хв (отжиг праймерів),

72 о С - 2 хв (полімеризація).

19 -30 цикли: 95 ° С - 1 хв,

50 о С - 1 хв,

72 о С - 2 хв.

31 цикл: 95 о С - 1 хв,

50 о С - 1 хв,

72 о С - 10 хв.

СУБКЛОНІРОВАНІЕ ДНК


Фрагменти ДНК, отримані в результаті ПЛР, поділяли в 1% агарозному гелі і виділяли як описано в п. Виділення ДНК з гелю. Потім брали в облогу ДНК етанолом, розчиняли в 5-10 мкл води і додавали компоненти для видалення виступаючих нуклеотидів з 3 'кінця ДНК:

1 мкл 10-кратного буфера (200 мМ трис-HCl, рН 8,2, 100 мМ KСl, 60 мМ (NH 4) 2 SO 4, 20 мМ MgCl 2, 1% тритон Х-100 і 100 мкг / мл бичачий сироватковий альбумін),

1 мкл 10 мМ dНTФ,

1 мкл Pfu ДНК полімерази (2,5 Е.А. / мкл),

воду до кінцевого об'єму 10 мкл.

Суміш інкубували 30 хв при 72 о С після чого охолоджували до 0 ° С і додавали компоненти для зшивання з вектором pBluescript KS (+) по сайту рестрикції Sma I:

1 мкл розщепленого вектора (0,5 мкг),

1 мкл 10-кратного буфера (50 мМ трис-HCl, рН 7,5, 7 мМ MgCl 2, 1 мМ ДТТ),

1 мкл 10 мМ дATФ,

1 мкл ДНК лігази фага Т4 і воду до кінцевого об'єму 10 мкл.

Суміш інкубували одну добу при кімнатній температурі і потім використовували для хімічної трансформації клітин E.coli. Трансформовані клітини висівали на селективну середу: 1,5% LB-агар з ампіциліном (50 мкг / мл), тетрацикліном (15 мкг / мл), ІПТГ (2 мМ), X-Gal (500 мкг / мл) і інкубували 14 годин при 37 о С. Після цього відбирали колонії білого кольору (Маніатіс і ін., 1984; Dieffenbach and Dveksler, 1995).


СКРИНІНГ БІБЛІОТЕКИ кДНК


Бібліотеку кДНК висували на чашки Петрі з 1,5% LB-агаром з ампіциліном (50 мкг / мл) з розрахунку 4000 колоній на чашку і інкубували при 37 о С до тих пір поки колонії не досягнуть 0,5-1 мм в діаметрі. Колонії переносили на нейлонову мембрану і інкубували при кімнатній температурі в денатуруючих розчині (0,5 М NaOH, 1,5 М NaCl) протягом 7 хв і два рази по 2 хв в нейтралізуючому розчині (1,5 М NaCl, 0,5 М трис-HCl, рН 7,5). Потім споліскували мембрану в 2-кратному буфері SSC (0,3 М NaCl, 0,03 М цитрат натрію), висушували і фіксували ДНК протягом 10 хв ультрафіолетовим випромінюванням з довжиною хвилі 310 нм. Після цього мембрану поміщали в 50 мл предгібрідізаціонного розчину (розчин 1), що містить:

6-кратний SSC (0.9 М NaCl, 0,09 М цитрат натрію),

5-кратний розчин Денхардта (0,1% бичачий сироватковий альбумін, 0,1% фікол, 0,1% полівінілпіролідон),

0,5% SDS,

10% декстран сульфат,

500 мкг денатурірірованной ДНК курчати,

і інкубували 1 годину при 55 о С. Після цього додавали мічену 32 P-дATФ ДНК зонда і инкубировали 12-18 годин при 55 о С при постійному погойдуванні.

Після гібридизації проводили промивання мембрани два рази по 10 хв в 200 мл 2-кратного SSC + 0,1% SDS при кімнатній температурі, 15 хв в 1-кратному SSC + 0,1% SDS% при 55 о С і два рази по 10 хв в 0,1-кратному SSC + 0,1% SDS при 55 о С. Експонування проводилося протягом 12 годин при -70 ° с з рентгенівською плівкою (Маніатіс і ін., 1984).


ВИЗНАЧЕННЯ НУКЛЕОТИДНОЇ ПОСЛІДОВНОСТІ ДНК


Нуклеотидну послідовність ДНК визначали за методом Сенгера (Sanger et al., 1977). 5 мкг плазмідної ДНК, очищеної гель-фільтрацією на колонці з біогелем П-10, денатуровані в 50 мкл 0.2 М NaOH при 37 о С протягом 30 хв, потім додавали 5 мкл 3 М NaAc, рН 5,1, подвійний обсяг етанолу і інкубували 30 хв при температурі -70 о С. Після цього брали в облогу ДНК центрифугуванням при 12000 g протягом 12 хв і промивали осад 100 мкл 80% етанолу. Осад ДНК висушували при кімнатній температурі і розчиняли в 7,5 мкл води, додавали 2 мкл 5-кратного буфера (200 мМ трис-HCl, рН 7,5, 100 мМ MgCl 2, 250 мМ NaCl), 0,5 мкл праймера ( 50 нг) і інкубували 30 хв при 37 о С. Після цього пробірку поміщали в лід і додавали 1 мкл 0,1 М ДТТ, 2 мкл 1,5 мкМ дНTФ без дATФ, 0,5 мкл розчину 35 S-дATФ і 2 мкл ДНК полімерази фага Т7 (2,5 Е.А. / мкл). Потім інкубували 3 хв при 20 о С і відразу відбирали по 3,5 мкл в чотири пробірки, кожна з яких містила по 2,5 мкл 80 мкМ суміші чотирьох дНTФ, 50 мМ NaCl і 8 мкМ одного з ддНTФ. Інкубували 5 хв при 37 о С і додавали по 4 мкл стоп-розчину (95% формамід, 20 мМ Na 2 ЕДТА, 0,05% бромфеноловий синій, 0,05% ксилен ціанол). Отримані зразки інкубували 3 хв при 100 ° С, швидко охолоджували до 0 ° С і відбирали по 2 мкл для електрофорезу в денатуруючих поліакриламідному гелі, що має склад:

6% акриламід,

8 М сечовина,

1-кратний гліцерин-толерантний буфер (1,1% трис, 0,36% таурин, 0,02% Na 2 ЕДТА).

Електрофорез проводили при напрузі 40 В / см. Потім гель витримували 30 хв в 10% уксксной кислоті, висушували і експонували 12 годин при кімнатній температурі з рентгенівською плівкою (Маніатіс і ін., 1984).


Саузерну блотом ГІБРИДИЗАЦІЯ


10 мкг геномної ДНК, виділеної з печінки стерляді, инкубировали протягом 2 годин з ендонуклеаза рестрикції Pst I і Pvu II (по 50 Е.А.) при 37 о С в буфері, що містить 100 мМ NaCl, 10 мМ трис-HCl, рН 7,5, 10 мМ MgCl 2, 100 мкг / мл бичачий сироватковий альбумін, 6 мМ 2-меркаптоетанол. Потім екстрагували ДНК послідовно рівними обсягами фенол-хлороформу (1: 1) і хлороформу, брали в облогу ДНК двома обсягами етанолу, розчиняли у воді і наносили на 1% агарозному гель. Електрофорез проводили при напрузі 1 В / см і температурі 12 о С протягом 12 годин. Потім гель инкубировали при кімнатній температурі 30 хв в 0,25 М HCl, 30 хв в денатуруючих розчині (0,5 М NaOH, 1,5 M NaCl) і 10-15 хв в розчині 1 (0,25 М NaOH, 1, 5 M NaCl). Після цього ДНК переносили на нейлонову мембрану методом вакуумного перенесення в розчині 1. Плівку споліскували в 2-кратному SSC, висушували і фіксували ДНК протягом 10 хв ультрафіолетовим випромінюванням з довжиною хвилі 310 нм.

Предгібрідізацію проводили при 55 о С протягом 1 години на розчині 1 (див. Скринінг бібліотеки кДНК). Гібридизація тривала 12-16 годин при 55 о С з концентрацією зонда не більше 10 нг / мл.

Відмивання проводили два рази по 10 хв в 2-кратному SSC + 0,1% SDS при кімнатній температурі і один раз 15 хв в 1-кратному SSC + 0,1% SDS при 55 о С. Експонування тривало 12 годин при -70 о З (Маніатіс і ін., 1984).

РЕЗУЛЬТАТИ


КОНСТРУЮВАННЯ БІБЛІОТЕКИ кДНК І ЇЇ СКРИНІНГ


Як джерело мРНК брали лейкоцити периферичної крові стерляді. На основі цієї мРНК сінезіровалі кДНК. Отримані молекули кДНК клонували в плазмідної вектора pBluescript KS (+), після чого трансформували цим вектором клітини E.coli штаму XL-1 Blue MRF '. В результаті цього була отримана бібліотека кДНК показністю 6 мільйонів клонів. Бібліотеку ампліфікували до обсягу 5 x 10 11 клітин.

Сумарні плазмидную ДНК бібліотеки виділяли і використовували в ПЛР з парою праймерів, один з яких гомологічних ділянці вектора поблизу сайту клонування молекули кДНК і розташовується в кодує орієнтації. Другий праймер вироджений, відповідний найбільш консервативному ділянці послідовності J-сегментів L-ланцюгів ІГ хребетних в некодирующей орієнтації (рис. 10).

Один з фрагментів ДНК, отриманих в результаті ПЛР, відповідав очікуваному розміру (370 пн). Цей фрагмент виділяли і субклоніровалі в векторі pBluescript KS (+). Визначення нуклеотидної послідовності цього фрагмента показало, що він гомологичен генам V області L-ланцюгів ІГ (Рис. 11).

Цей фрагмент був використаний в якості зонда для скринінгу бібліотеки кДНК лейкоцитів стерляді.Скринінг 4000 колоній бібліотеки кДНК в м'яких умовах гібридизації дозволив виявити п'ять клонів з розміром вставки кДНК від 800 до 1050 вт. Для чіткого поділу клонів проводили вторинний скринінг бібліотеки кДНК, після чого виділені клони ампліфікували.










прамер Т3

5'-GCAATTAACCCTCACTAAAGG-3 ';


J-праймер

5'-A (G / C) (T / C) (T / C) TGGT (T / G / C) CCTTTTCC (A / G) AA-3 '


Мал. 10. Схема ПЛР. Т3 праймер розташовується поблизу сайту клонування молекули кДНК і компліментарен некодирующей ланцюга, J-праймер гомологичен ділянці кодує ланцюга J-сегмента генів L-ланцюгів ІГ хребетних. Очікувана довжина продуктів близько 400 вт.

ВИЗНАЧЕННЯ ПЕРВИННОЇ СТРУКТУРИ


Визначено нуклеотидних послідовність вставки кДНК клону В1. кДНК клону В1 розміром 1050 пн представляла собою повнорозмірну копію зрілого гена L-ланцюга ІГ і містила 5'-нетрансльовані область, послідовність кодує лідерних пептид, V область, С область, а також 3'-нетрансльовані область (Рис. 11). На основі первинної структури клона В1 сконструювали і синтезували три праймера, відповідних консервативним районам V і C області і використовували їх для визначення нуклеотидної послідовності клонів Е4 і С2. Послідовність клону Е4 була визначена тільки в області, що примикає до Т3 промотору вектора. За винятком 2 нуклеотидів вона повністю ідентична послідовності В1. Послідовність клону С2 мала химерний характер. В області Т3 промотора вона містила фрагмент відповідний 3 'частини З сегмента клону B1 з замінами декількох нуклеотидів. У той же час використання для визначення послідовності праймерів V і C області показало, що ця вставка містить додатково перебудований ген легкої ланцюга, що містить велику частину V сегмента і другий З сегмент, що відрізняється від першого в одній позиції. Оскільки поки не вдалося визначити послідовність в області стику цих двох фрагментів вставки, не можна сказати, чи знаходяться вони в одній або різних орієнтаціях. Мабуть, подібний химерний характер має послідовність клону D2 (дані не показані).


Порівняльний аналіз ПЕРВИННОЇ СТРУКТУРИ


Нуклеотидну і передбачені амінокислотні послідовності клону В1 порівнювали з послідовностями V і C генів L-ланцюгів ІГ інших видів хребетних (Рис 12). На аминокислотном рівні V область має найбільшу схожість з V-областями L-ланцюгів класу F і G печерного сомика і з V-областю L1 класу ІГ форелі (63-71%). І ті й інші належать до каппа-типу L-ланцюгів. При пошуку гомологів в повному банку послідовностей ІГ ссавців перші 100 позицій з найбільшим подібністю представляли собою також V каппа області.

З-область клону В1 має на аминокислотном рівні приблизно однакове і не дуже значну схожість з широким спектром С-областей L-ланцюгів ІГ хрящових і костистих риб (41-44%). На нуклеотидном рівні найбільш близькими гомологами В1С гена є гени III класу хрящових риб (65%).


АНАЛІЗ геномної ОРГАНІЗАЦІЯ


Геномної організацію локусу генів L-ланцюгів ІГ стерляді оцінювали методом Саузерн блот гібридизації. Геномної ДНК виділяли з печінки стерляді. ДНК розщеплювали ендонуклеаза рестрикції Pst I і Pvu II. Після електрофоретичного розділення і перенесення фрагментів ДНК на нітроцелюлозну мембрану проводили гібридизацію в м'яких умовах. Як зонда на V-гени використовували фрагмент, отриманий в результаті ПЛР (див. Конструювання бібліотеки кДНК і її скринінг). Як С-зонда використовували ділянку кДНК клону В1, який кодує C L сегмент, який вирізали по сайтах рестрикції ендонуклеаза EcoR V- Xho I.

V-зонд виявляв більш 20 гибрідизуючою фрагментів ДНК, в той час як С-зонд гібрідізоваться тільки з 3-4 фрагментами (рис. 13).


5 'нетрансльовані область |> лідерних пептид

1 15 30 45 60 75 90

B1. .TTCATGGCAACA GAATCCACAACAACA ATGACTTTTATCAGC ATCTTCATCTGGGCA CTTGTCATCTGCACT CAGGAATCCAGTGGA

E4 CCC ---- A ------- --------------- --------------- ------ --------- --------------- ---------------

C2. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

C2 (T3). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

PCR. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .


|> V сегмент FR 1 |> CDR 1

105 120 135 150 165 180

B1 CAGTATACTGTGACT CAGACTCCAGCAGAG AAATCTGTTCTCCCA GGAGACACAGTCGCT CTCAACTGTAAAGTC AACAGCGCAGTCCTT

E4 --------------- -------- G ---- T- --------------- ---- ------. . . . . . . . . . . . . . . . . . .

C2. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

C2 (T3). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

PCR. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .


|> FR 2 |> CDR 2 |> FR 3

195 210 225 240 255 270

B1V GGTAATACGTACCTG CACTGGTACCAACAG AAACCTGGAGAAGCT CCCAAACTCCTGATC TATAGGGCAAGTACC CTTGAGTCTGGGATC

E4. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

C2. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ---- --- C -----------

C2 (T3). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

PCR. . . . . . . . . . . . . . . . . .------------ ----------- A --- --- TAT ---- T - AG --- C ------ -N ---


285 300 315 330 345 360

B1 CCAACTCGTTTCAGT GGCAGTGGATCTGGG ACTGACTTCACTCTG ACCATCAGTGGAGTC CAGGCTGAAGATGAA GGAGATTACTACTGT

E4. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

C2 -------- C ---- C- --------------- --------------- ---- ----------- --------------- -------- T ------

C2 (T3). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

PCR --------------- ------------ TT- --------------- ----- ---------- ------------- C- ---------------


|> CDR 3 |> J сегмент |> З сегмент

375 390 405 420 435 450

B1 GTCAGTGTACACTAC TCCAGCAGTAGATAT GTGTTGACTTTCGGG CCCGGGACCAAACTA ATTGTGAAATCTGGA AGCCCCACTGCTCCT

E4. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

C2 CAG --- TC ------- C ---------- CG- -NCC-C -------- A --A -------- G - G G -------------- -A -------------

C2 (T3). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

PCR CAG --- CAC --- ACT C --- ATG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .


465 480 495 510 525 540

B1 TCCTCCGTCTCCCTG CTTCCTCCCTCCAAG CTGGAGCTCGACTCA AAGGGTAAAGCCACC CTGGTCTGCCTGGTG AATAATTTCTACCCT

E4. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

C2 --------------- --------------- ------------ A-- ---- -C --------- TG ------------- -------------- C

C2 (T3). . . . . . . . . . . . . . . . . . . . . . . . . . -C --------- T -------------- -------------- C

PCR. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .


555 570 585 600 615 630

B1 GATGTCGTGGATATC AAGTGGACGGTGGAC GGGGTGGCCCAGTCG TCTGGTGTGCTGACC AGCACAATGAAGCAG AAGGATGGGAAATAC

E4. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

C2 --------------- -------------- T ---- C ---------- ---- ----------- --------------- ----- C ---------

C2 (T3) --------------- -------------- T ---- C ---------- - -------------- --------------- ----- C ---------

PCR. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .


645 660 675 690 705 720

B1 AGTGCAAGCAGCAGC CTGACCCTCACCAAG GCCGTGTGGAACAGC AAGGAGACATACACC TGCACTGTGAAGCAC GAGGCTGTGAGCACT

E4. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

C2 --------------- --------------- -A ------------- ---- ----------- --------------- ---------------

C2 (T3) --------------- --------------- -A ------------- - -------------- --------------- ---------------

PCR.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .


|> 3 'нетрансльовані область

735 750 765 780 792

B1 CCCAGGAGCGAGTCC ATCAAGAGGAGCGAG TGCACACTATTAGAT GCCtaaAGG. . . . . . . . .

E4. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

C2 --G ---------- T- --------------- --------------- --- taaG -CAAGAGA ATCCGTGTGATT

C2 (T3) --G ---------- T- --------------- ---------------. . . . . . . . . . . . . .

PCR. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .


Мал. 11. Нуклеотидная послідовність повнорозмірною кДНК клону В1 і часткова послідовність кДНК клонів Е4 і С2 і продукту ПЛР. Послідовність кДНК клону С2 визначалася з використання праймерів V1, V2, C1 (позначення С2) і Т3 (позначення С2 (Т3)). Прочерк означає ідентичність в цій позиції з кДНК клону В1, FR - каркасні ділянки, CDR - гіперваріабельні ділянки V області.


A


AruIgLBV QYTVTQTPAEKSVLPGDTVALNCKVNSAVLGNTYLHWYQQKPGEAPKLLIY * RASTLESGIPTRFSGSG ** SGTDFTLTISGVQAEDEGDYYCVSV

IpuIgLVG -V ------- V - A --- E - TI - RT-PY * -H * ----------------- K * F -NQ-H ---- A ------ ** - S ---------- T - A ----- QY 71%

OmyIgLV1 -I ------ EM-AFQT - ATR-RF-KPSPPC ** VA ------- G - Q ---- * YT - Q - TS ----- - ** - S ------------- A ----- QY 63%

XIaIgLVR -VVL - S-DYV - S - E - TIT - AS-SS --- ** ------- S-QT ------ * GT-NRYT-TE- ----- ** ---------- RME --- AA ---- QQY 58%

Rabbit kV IV ivm ---- ss --- pv ---- ti - qasqs-ys-nr-af ----- qp ------ * k ---- a - vs- -k --- ** --- q ------ d - ca-aat --- rva 57%

GciIgLVIII -M - S-PVL - GL-Q - TIT-TASQS-YS - ** - A ---- RE-QK-S ---- * A-TNRYTEVSE ------ ** --- S ----- RN - P - VA ---- QGT 48%

HulV2 -SAL - * - ASV-GS - QSITIS-TGT-SSYNL ** VS ---- H - K ---- M - * EG-KRP - VSN ----- K ** --NTAS - T - L ----- A ---- CY 47%

HfrIgLVII GTVL - * - SM-TSQ-K - KIT-TISGGGTYY ** SS - W ---- S - VFVWRDYD - RG ---- D - T - RNT-SNVMH --- TD - SR-TA ----- AW 41%

XlaIgLIII -VSI - * - VSE - KL-E - RIS-TLSG-SGYH ** VN ----- A-NR-RY-LRFYSDSNK ** HQD ----- KDSPNNIGY --- K-ALL --DA ---- ATW 35%

HfrIgLV1 VPVLN --- ISDP-SA-E-SE-K-AMQNGGSYY ** MS - RR ----- VFVL ** YQ - SG-IYRD - KP-RDT-SNSHI --- GSLEPG-SAV- --AAN 31%


Б


AruIgLCB GSPTAPSSVSLLPPSKLELDSKGKATLVCLVNNFYPDVVDIKWTVDGVAQSSG * VLTSTMKQK ** DGKYSASSSLTLTKAVWNSKETYTCTVKHEAVSTPRSESIKRSECTLLDA

CplIgLCII -RS * PT - V ---- SDQITA-NM ------- SG-V-GAAE-E ----- SVRGN - * - E - RIQ-EA * -NTF-V- -Y --- SASD --- HLSVK-ETQAN-LQT - S - SM 44%

HfrIgLCIII EKSQPTLT-M --- PE-VKA - T ------ ADH ---- E-GVE-KK - AIA - * - Q - NYLRAS * -ST - C - L-- -SGSD-E-NARFS-ALT-ETL-SLK-VS ---- V 42%

IpuIgLCF G - VKP ----- L - SQS * ESSL - LPAYS-QGALVS ----- SEVKD - * ---- AEER - ** TDG-TR - T --- S - L -EKG-EFV-KS-DN-DH-VT ** FRK-Q-EV 41%

Hu kappa TV-AP-VFIF --- * D-QLKS-T-SV --- L ----- REAKVQ-K - NAL - GN * SQE-VTE-DSK-ST - L - T --- S - DYEKHKV-AET-QGL-S-VTK-FN-G-- 39%

XlaIgLC3 GDVK - * --- YF --- * V-EIATK --- V - SLSD-T-RGATVK-L --- KD-TDS * -QS-GLSKQS * -NL-ME - YS-- ADQ-LRH --- SKSQ ** GKEIIQTL ----- V 38%

Hu lambda1 QK-NPT-TF --- * S-ELQAN ------- ISD --- GA-TVA-KA - SPVKA - * - E-TKPSKQS * NN - A --- YS-- PEQ-K-HRS-SQTE ** GSTVEKTVAPT - S 37%

HfrIgLCI SEDRKP-VL ----- * S-EIDS-W --- S --- SR-K-GF-RVL-R - DKETD - * - TG-VSTDS * -QS - L - YLRVPATA --KGSS --- SD-GSL-S-LLKT-SSTA-SD 37%

XlaIgLCS ND-KPA-FIFK - * D-QVKE-NP-A --- I --- F-RDLTVT-K - SQDV - SD-K - DFM-ES * -ST - Q - MT --- DK-DKADKFE-LKK ** TAQLTQSFSK-QS 34%

IpuIgLCG LTQP - TV ---- SV - Q * QE-V ----- AYKGF-SDWRLS-K --- SSW --- * ESR-SAVLQA * - L - W - TS-HPEQ -RN- * VV - EASKDN * QP-VVSTVNTEQ- 33%


Мал. 12. Порівняння амінокислотних послідовностей V (А) і С (Б) областей L-ланцюга ІГ стерляді з послідовностями інших видів хребетних. Дефіс позначає ідентичність в даній позиції. Зірочка позначає делецию амінокислотних залишків. Зліва вказані відсотки подібності. Видові позначення: Aru - стерлядь, Ipu - печерний сомик, Omy - райдужна форель, Xla - шпорцевая лагушка, Gci - акула-нянька, Hu - людина, Cpl - піщана акула, Hfr - разнозубих акула.


Мал. 13. Саузерн блот гібридизація. Геномна ДНК була виділена з печінки і оброблена ендонуклеаза рестрикції Pst I Pvu II. Гібридизацію проводили в м'яких умовах з використанням зондів, гомологічних V L (а) і C L (б) генним сегментам L-ланцюгів ІГ стерляді. З V-зондом гібрідізоваться більше 20 фрагментів ДНК, в той час як з С-зондом гібрідізоваться тільки 3-4 фрагмента.

Обговорення результатів


В результаті проведеної роботи ідентифікований локус генів, що кодують L-цепи ІГ стерляді, представника підкласу кістково-хрящових риб. Порівняльний аналіз структури V генів цього локусу вказує, що він відноситься до каппа типу. Результати порівняльного аналізу З областей менш інформативні, що само по собі не дивно, так як С-гени L-ланцюгів ІГ значно менш консервативні ніж V-гени. Проте, той факт, що на нуклеотидном рівні С-ген стерляді має найбільшу схожість з каппа-подібними генами III класу хрящових риб, також свідчить про те, що виявлений локус відноситься до каппа типу.

кДНК клонів В1, С2, Е4, а також фрагмент, отриманий за допомогою ПЛР, містять близькоспоріднені V-гени. Відмінності між ними сконцентровані в основному в області 3-го гіперваріабельної району. Послідовності двох виявлених J-сегментів відрізняються по 10 нуклеотидам, тобто, вони представляють собою різні геномні сегменти. Незначні відмінності виявлені також між трьома послідовностями С-генів. З-сегмент клону В1 відрізняється від повного З-сегмента клону С2 по 9 позиціям, з яких 5 ведуть до заміни амінокислоти. Мабуть, ці последовательсти також представляють собою різні зародкові гени.

Аналіз структурної організації локусу з допомогою Саузерн блот-гібридизації вказує, що у стерляді є множинні V L гени. Точна оцінка їх кількості неможлива, але наявність понад 20 смуг гібридизації з різною інтенсивністю сигналу, за аналогією з численними літературними даними, дозволяє говорити про декілька десятків копій.

При використанні С-зонда кількість смуг в м'яких умовах гібридизації не перевищує 4-х. З огляду на можливість алелізм можна говорити про наявність в цьому локусі 2-4х генів.

Яскраво виражене кількісна перевага V генів над С-генами є характерною ознакою сегментарної форми організації локусу. У хрящових і костистих риб з кластерної організацією генів L-ланцюгів кількість V і З генів дуже велика і приблизно однаково, що відбивається в подібній картині блот-гібридизації. Отримані нами результати є серйозною підставою для того, щоб стверджувати, що у стерляді організація генів L-ланцюгів каппа-подібного типу має сегментарний характер, подібний організації каппа локусу ссавців.

Ці дані вказують на те, що перехід від кластерної до сегментарної організації стався в філогенезі хребетних дуже рано, можливо вже у стародавніх первинно-кісткових.

ВИСНОВКИ


1. Сконструйована бібліотека кДНК лейкоцитів стерляді показністю 6х10 6 незалежних клонів. ПЛР ДНК бібліотеки за допомогою виродженого праймера, соотвествующего J сегменту генів ІГ, дозволив виявити фрагмент ДНК довжиною 370 пн, гомологічний V генам ІГ хребетних.

2. З бібліотеки кДНК з використанням продукту ПЛР як зонда виділено п'ять клонів, що містять вставки кДНК генів L-ланцюгів ІГ. Порівняльний аналіз первинної структури кДНК клонів показав, що вони є членами однієї родини генів і мають найбільшу схожість з генами каппа типу.

3. Відповідно до результам геномного блот-аналізу ідентифіковане сімейство містить кілька десятків V генів і тільки 2-4 С гена, що вказує на сегментарну форму його організації.

4. Отримані дані вказують що перехід від кластерного типу організації генів ІГ, характерного для хрящових риб, до сегментарному, присутньому у всіх ссавців, стався в еволюції в період появи первинно-кісткових риб.

СПИСОК ЛІТЕРАТУРИ


Мазін А. В., Кузнеделов К. Д. та ін. Методи молекулярної генетики та генної інженерії. Новосибірськ, 1988. 333 с.

Маніатіс Т., Фрич Е., Сембрук Д. Молекулярне клонування. М .: Світ, 1984. 480 с.

Пол У. (ред.) Імунологія. М .: Світ, 1987. Т. 1. 476 с.

Ромер А. С. і Парсонс Т. С. Анатомія хребетних. М .: Світ, 1992. 358 с.

Фримель Г. (ред.) Імунологічні методи. М .: Медицина, 1987. 472 с.

Юдкін І. І. Іхтіологія. Москва-Ленинград: Піщепроміздат, 1941.

Aguilera RJ, Akira S., Okazaki K., Sakano H. A pre-B cell nuclear protein wich specifically interacts with the immunoglobulin VJ recombination sequeces // Cell. 1987. V. 51. P. 909-917.

Anderson MK, Shamblott MJ, Litman RT, Litman GW Generation of immunoglobulin light chain gene diversity in Raja erinacea is not associated with somatic rearrangement , an exception to a central paradigm of B cell immunity // Journal of Experimental Medecine. 1995. V. 182. P. 109-119.

Bengten E. The immunoglobulin genes in Atlantic cod (Gadus morhuna) and rainbow trout (Oncorhynchus mykiss) // Dissertations from the Faculty of Science and Technology. 1994. V. 19.

Bengten E., Leanderson T., Pilstrom L. Immunoglobulin heavy chain cDNA from Atlantic cod (Gadus morhuna L.): nucleotide sequences of secretory and membrane form show an unusual splicing pattern // European Journal of Immunology. 1991. V. 21. P. 3027-3033.

Blomberg B., Tonegawa S. DNA sequences of the joining regions of mouse l light chain immunoglobulin genes // Proc. Natl. Acad. Sci. USA. 1982. V. 79. P. 530.

Boyle JS, Lew AM An inexpensive alternative to glassmilk for DNA purification // Trends in Genetics. 1995. V. 11. No. 1. p. 8.

Chomczynski P. and Sacchi N. Single-step method of RNA isolation by acid guanidinum thiocyanate-phenol-chloroform extraction // Analytical biochemistry. 1987. V. 162. P. 156-159.

Daggfeldt A., Bengten E., Pilstrom L. A claster type organization of the loci of the immunoglobulin light chain in Atlantic cod (Gadus morhuna L.) and rainbow trout (Oncorhynchus mykiss Walbaum) indicated by nucleotide sequences of cDNAs and hybridization analysis / / Immunogenetics. 1993. V.38. P. 199-209.

Dieffenbach CW and Dveksler GS (edit). PCR primer. A laboratory manual. New York: Cold Spring Harbor Laboratory Press, 1995. 714 p.

Durdik J., Moore MW, Selsing E. Novel k light-chain gene rearrangements in mouse l light-chain-producing B limphocytes // Nature. 1984. V. 307. P. 749-752.

Flajnik MF The immune system of ectothermic vertebrates // Veterinary Immunology and immunopathology. 1996. V. 54. P. 145-150.

Ghaffari SH and Lobb CJ Structure and genomic organization of immunoglobulin light chain in the channel catfish // The Journal of Immunology. 1993. V. 151. P. 6900-6912.

Gilbert W. Evolution of antibodies: the road not taken // Nature. 1990. V. 320. P. 485.

Greenberg AS, Steiner L., Kasahara M., Flajnik MF Isolation of a immunoglobulin light chain cDNA clone encoding a protein resembling mammalian k light chains : Implications for the evolution of light chains // Proc. Natl. Acad. Sci. USA. 1993. V. 90. P. 10603-10607.

Haire RN, Ota T., Rast JP, Litman RT, Chan FY, Zon LI, Litman GW A third Ig light chain gene isotype in Xenopus laevis consists of six distinct VL families and is related to mammalian l genes // The Journal of Immunology .1996. V. 157. P. 1544-1550.

Hesse JE, Lieber MR, Mizuuchi K., Gellert M. V (D) J recombination: the functional difinition of the joining signals // Genes Dev. 1989. V. 3. P. 1053-1061.

Hieter PA, Hollis GF, Korsmeyer SJ, Waldmann TA, Leder P. Clastered arrangement of immunoglobulin l constant region genes in man // Nature. 1981. V. 294. P. 536.

Hieter PA, Maizel JV, Leder J., Leder P. Evolution of human immunoglobulin k J region genes // J. Biol. Chem. 1982. V. 257. P. 1516.

Hohman VS, Schluter SF, Marchalonis JJ Complete sequence of a cDNA clone specifying sandbar shark immunoglobulin light chain: Gene organization and implications for the evolution of light chains // Proc. Natl. Acad. Sci. USA. 1992. V. 89. P. 276-280.

Hohman VS, Schuchman DB, Schluter SF, Marchalonis JJ Genomic clone for sandbar shark l light chain : Generation diversity in the absence of rearrangement // Proc. Natl. Acad. Sci. USA. 1993. V. 90. P. 9882-9886.

Hsu E., Lefkovits I., Flajnik M., Pasquier LD Light chain heterogeneity in the amphibian Xenopus // Molecular Immunology. 1991. V. 28. P. 985-994.

immunoglobulin genes and the antibody repertoire // Molecular Biology Evolution. 1993. V. 10 (1). P. 60-72.

Litman GW, Rast J. p., Shamblott MJ, Haire RN, Michele H., Roess W., Litman R. T, Hinds-Frey KR, Zilch A., Amemiya CT Phylogenetic diversification of Lobb CJ, Olson MOJ, Clem WL Immunoglobulin light chain classes in a teleost fish // The Journal of Immunology. 1984. V. 132. P. 1917-1923.

Lundqvist M., Bengten E., Stromberg S., Pilstrom L. Ig light chain gene in the siberiah sturgeon (Acipenser baeri) // The Journal of Immunology. 1996. V. 157. P. 2031-2038.

Maisey JG Chondrichthyan phylogeny: a look at the evidence // J. Ven. Paleont. 1984. V. 4. P. 359-371.

Rast JP, Anderson M. k., Ota T. Litman RT, Margittai M., Shamblott MJ, Litman GW Immunoglobulin light chain class multiplisity and alternative organizational form in early vertebrate philogeny // Immunogenetics. 1994. V. 40. P. 83-89.

Reynaund CA, Anquenz V., Grimal H., Weill JC A hyperconversion mechanism generates the chicken light chain preimmune repertoire // Cell. 1987. V. 48. P. 379-388.

Roitt I., Brodstoff J., Male D. Immunology. London: Mosby-Year Book Europe, 1993.

Romer AS Vertebrate Paleontology. Chicago: University Chicago Press, 1966.

Sakano H., Huppi K., Heinrich G., Tonegawa S. Sequences at the somatic recombination sites of immunoglobulin light-chain genes // Nature. 1979. V. 280. P. 288.

Sakano H., Maki R., Kurosawa Y., Roeder W., Tonegawa S. Two types of somatic recombination are necessary for the generation of complete immunoglobulin heavy-chain genes // Nature. 1980. V. 286. P. 676.

Sanger F., Niklen, S., Coulson AR DNA sequencing with chain-terminating inhibitors // Proc. Natl. Acad. Sci. US A. 1977. V. 74. P. 5463-5467

Schatz GD, Oettinger AM, Schlissel MS V (D) J recombination: molecular biology and regulation // Annual Review of Immunology. 1992. V. 10. P. 359-383.

Schwager J., Burckert N., Schwager M., Wilson M. Evolution of immunoglobulin light chain genes: analysis of Xenopus IgL isotypes and their contribution to antibody diversity // The EMBO Journal. 1991. V. 10. P. 505-511.

Seidman JG, Max EE, Leder PA A k immunoglobulin gene is formed by site - specific recombination without further somatic mutation // Nature. 1979. V. 280. P. 370.

Shamblott MJ and Litman GW Genomic organization and sequences of immunoglobulin light chain genes in a primitive vertebrate suggest coevolution of immunoglobulin gene organization // The EMBO Journal. 1989. V. 8. P. 3733-3739.

Shankey TV and Clem LW Phylogeny of immunoglobulin structure and function. IX. Intramolecular heterogeneity

of shark 19S IgM antibodies to the dinitrophenyl hapten //

J. Immunol. 1980. V. 125. P. 2690-2698.

Stavnezer J., Kekish O., Batter D., Grenier J., Balazs I., Henderson E., Zegers BJ Aberrant recombination events in B cell lines derived from k -deficient human // Nucl. Acids Res. 1985. V. 13. P. 3495-3514.

Stewart SE, Pasquier LD, Steiner LA Diversity of expressed V and J regions of immunoglobulin light chains in Xenopus laevis // European Journal of Immunology. 1993. V. 23. P. 1980-1986.

Strob U. Transgenic mise with immunoglobulin genes // Annual Review of Immunology. 1987. V. 5. P. 151-174.

Thompson GB and Neiman PE Somatic diversification of the chicken immunoglobulin light chain gene is limited to the rearranged variable gene segment // Cell. 1987. V. 48. P. 369-378.

Tonegawa S. Somatic generation of antibody diversity // Nature. 1983. V. 302. P. 575-581.

Udey JA, Blomberg B. Human l light chain locus: organization and DNA sequences of three genomic J regions // Immunogenetics. 1987. V. 25. P. 63.

Wai Lin Tung, King-C. Chow. A modified medium for efficient electrotransformation of E.coli // Trends in Genetics. 1995. V. 11. No. 4. Р. 128-129.

Wilson M., Hsu E., Marcuz A., Courent M., Pasquier LD, Steinberg C. What limits affinity maturation of antibodies in Xenopus: the rate of somatic mutation or the abilityto select mutants? // The EMBO Journal. 1992. V. 11. P. 4337.

Zezza DJ, Mikoryak CA, Schwager J., Steiner LA Sequence of C region of L chains from Xenopus laevis Ig // The Journal of Immunology. 1991. V. 146. P. 4041-4047.

Zezza DJ, Stewart SE, Steiner LA Genes encoding Xenopus laevis Ig L chains . Implications for the evolution of k and l chains // The Journal of Immunology. 1992. V. 149. P. 3968-3977.



МІНІСТЕРСТВО ОСВІТИ І НАУКИ

ОСВІТИ І НАУКИ УКРАЇНИ


Новосибірський державний університет


ФАКУЛЬТЕТ ПРИРОДНИХ НАУК


Кафедра цитології і генетики


КЛОНИРОВАНИЕ І АНАЛІЗ ГЕНОВ ЛЕГКИХ КІЛ імуноглобулінів стерляді


Дипломна робота

Денисова С. Г.


_____________


Науковий керівник

к.б.н. Таранін А. В.


_____________


Робота виконана в

лабораторії імуногенетики

Інституту цитології і

генетики СО РАН.


Новосибірськ 1 997



Скачати 121.67 Kb.